SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI58620 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI58620
Domain Number 1 Region: 52-470
Classification Level Classification E-value
Superfamily ARM repeat 1.38e-26
Family Armadillo repeat 0.013
Further Details:      
 
Domain Number 2 Region: 830-1011
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.64e-19
Family SPRY domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI58620
Sequence length 1211
Comment (Trichoplax adhaerens)
Sequence
MELILKKHHGWLIGSLTIIVSGVTLIKIVEAWRNRSRTVEERRASQLEAINLQDLQVLLG
SNNYLLRRSVQSVVIDIASQRQYLSYFIDQTSCDDIKEALHAVMALNLISKSAVHKKYLY
DLNGLQAICCCLMKWQGYQVRNDDVELIIQKERILKILCSTLVELICDPAEVVKLDSVGL
GAISVISKVIMNNRERPVTVKICLHMLALLSHVKSKDNISALTEIGQHKVYYTAIMYFTA
DDEEARYWAATLIHEFVCNDIYRKEISCIPTLMKSCRHALSKSDSGIQKIILKICSFLVM
KDDQFYKKILECKGFLNRLPICLASSDYEVAHWTLALVHDLAMIGKEVSAYILNAMDGFI
TCFTESLMNREDRTIIHLIAETLGFFCSCENFHTKILKENGIVPILRLLNNSDSGVRLWA
VTMLLNLSMSNDQCRLGIVKEGGVKCLVNLALSDSEQSQTSSLAAKTLVMLSLLELDPFM
MSVISRHTFEPSLLKLSQEIKEYVDAIDHDSIVVLCARGVSVNDITAKCWSSLSKLGLLQ
GSLSNHDSMVAYVGAKETCEGLLVNRIIQREILTPLISLLLCHPARDSVSKVTELELLHI
LARQKDNRQLMILYDGFLDYLSELIWHFCHIQAESLHLYPMVIYHCDGAIKILATLSAHN
ECCHQMCYCGIVDALASLILRINKHRIQLLDKQLDKGDDNYWGNDSSTSRVAFFSQAEDI
LSNSKPTRGSPRKSKATLQLASPLKRFCSTSSDLDTSFNNSFSLQASQISNSLDAYIAQS
NVDNPPTPRVGEYLSYEDTYATLTNLTTYCFARLIAYPLPGKRVRLCNYPALSASSRTPS
LIISPDHLEACNESWTFESVLADVYVCKGIYDHSKQIPDGWYYEVILKTPGIIQIGWARK
ECCMLPEKGYGVGDDEYSYAFDGSRCKKWHNMKNVPLQDHMRYGREWKEGDIISCLLSSS
GDISYWHNGNNLGIAFSNIDLSHNWYPGASLSTEQQCIFNFTGNEMHPFRYKMPSQYVAI
GSTPSFNKKSSKRKKKISISNSDSFNALEGRTIYVPDFMIYYEVSLQSISIDVEKYGFWW
TNNINKFYCKLSSDRKLTMPDGEEFDITEKQLIIGCGLCLPDLFGFFTVNGQQYGQYYKL
EIDDSIEGLPIPYFTNFNHRINYGESEFLYQAADKSKARLKQCKKLQELAILQSAANGRG
NPADFLDDYLN
Download sequence
Identical sequences B3S373
10228.JGI58620 XP_002114604.1.101920 jgi|Triad1|58620|fgeneshTA2_pg.C_scaffold_8000168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]