SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI59475 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI59475
Domain Number 1 Region: 2093-2252
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-44
Family MAM domain 0.0012
Further Details:      
 
Domain Number 2 Region: 2306-2466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-41
Family MAM domain 0.001
Further Details:      
 
Domain Number 3 Region: 1673-1834
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-41
Family MAM domain 0.002
Further Details:      
 
Domain Number 4 Region: 2511-2673
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-41
Family MAM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 24-178
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-40
Family MAM domain 0.0011
Further Details:      
 
Domain Number 6 Region: 528-692
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-40
Family MAM domain 0.0011
Further Details:      
 
Domain Number 7 Region: 342-507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-39
Family MAM domain 0.00087
Further Details:      
 
Domain Number 8 Region: 3183-3353
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.27e-39
Family MAM domain 0.0046
Further Details:      
 
Domain Number 9 Region: 1885-2044
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-38
Family MAM domain 0.0017
Further Details:      
 
Domain Number 10 Region: 2959-3120
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-36
Family MAM domain 0.0026
Further Details:      
 
Domain Number 11 Region: 1274-1432
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-36
Family MAM domain 0.0012
Further Details:      
 
Domain Number 12 Region: 3836-3996
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.44e-35
Family MAM domain 0.00084
Further Details:      
 
Domain Number 13 Region: 861-1023
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-34
Family MAM domain 0.0015
Further Details:      
 
Domain Number 14 Region: 697-857
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.02e-33
Family MAM domain 0.0014
Further Details:      
 
Domain Number 15 Region: 181-340
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-31
Family MAM domain 0.001
Further Details:      
 
Domain Number 16 Region: 3404-3565
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-22
Family MAM domain 0.00096
Further Details:      
 
Domain Number 17 Region: 1066-1226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-22
Family MAM domain 0.0047
Further Details:      
 
Domain Number 18 Region: 3626-3789
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-21
Family MAM domain 0.02
Further Details:      
 
Domain Number 19 Region: 2739-2912
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-21
Family MAM domain 0.0034
Further Details:      
 
Domain Number 20 Region: 1466-1627
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-18
Family MAM domain 0.012
Further Details:      
 
Domain Number 21 Region: 1231-1269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 22 Region: 3794-3833
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 23 Region: 2917-2955
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000851
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 24 Region: 4058-4104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 25 Region: 2700-2739
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000122
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 1633-1670
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 27 Region: 3590-3625
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 28 Region: 1849-1885
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 29 Region: 3145-3183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000602
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 30 Region: 2271-2306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 31 Region: 3358-3396
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000654
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 32 Region: 1033-1067
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 33 Region: 2476-2509
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000812
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 34 Region: 4016-4053
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000406
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 35 Region: 2051-2088
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000524
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI59475
Sequence length 4196
Comment (Trichoplax adhaerens)
Sequence
MATKVIALGLLLLCAVTAASAQAQFNCNFDSGFCGWAQPVNAPLNWTLNNGSTASFGTGP
SQDHTTGKGLFVYIEASFQLPNIAATLMSPMVASGQACITFWYHMYGPDIATLNVSATMN
GKDSLIWQRNGNQGNQWKQSNLQLNMNSNYQIKFVALRGSGFAGDISLDDISMTSSACPL
TTNCDFESGLCKWTQDTTDDFNWRRGKNGNDQNGSGPPTDHTYQSQLGYYAYTSSYSNAN
QKARLIFSPAFAPTPAVGKCMTFFYRLTGNAGSLKIFNQIGGNLGPVLWQEMGNQKGLWQ
PGLVTMNSTTGSWQPVFQSETSSGQGTIAIDDVSFYDQACPLPGNCNFENGLCTWMNARK
GDNFDWVRHQGSVPSSFTGPSVDHTLGTANGFYLYMEATGRSNGQKTVLQSMVFPAVPNG
RCLSFWYHMWSPFAFGTPSSLSVYIQRVNSNFGSILWLRNSSAGNVWKNAHVAFNSNQQY
QILFVAVRGQSSLSDIAIDDITFSTNCNTTLTQPTPSPTRVAPTTMPPTPYDCTFEKGFC
NWGQGVGTDTLNWTRHQGPTSSSDTGPSTDHTTGSASGWYAYVEGSHFSSNNSAQLYSAS
IPQSSGPMCLQFWYNMFGEDINVFNVYIVYSGNTNPRLLWTRRGNQGPGWKYAQIQVAQT
NSFQFMFETHHISGGYRSDIAIDDIKFNFQACPARQLCDFEDPGRCGFTQDINDNFDWTY
YTGKPSNQYAPANDHTTGTTRGHSFYANMQQKTNGATARLNSPERPPTANSCLRFWYIAY
GNSSYGSLSVYTQANGVLTKRWTRPTSTLLQRQQQWLGTQLTIKSQSPYFITFEAARGTA
GNGTIAIDDVQMTAGACPPLGDCSFEKGTCLWRNLHGSDQLDLLRWSGPTPSFGTGPSAD
HTTGTEAGHYVYLEASSANLNDNAIFYSPEFAPTSTTRCFTFWYYMYARTQSDMGKLSLS
VRSPNNASQIFNVSGYQGPRWNYAAVVIPTAATTNWLYFTVTRGSGLQSDIALDDFVLYN
GPCPTAAPTTPPNPCAVRCYSNFRCIPSNKVCDYIRDCPDGRDELNCGGCSFELGTCNYS
MNAGSDQWLRGRYGTPKTNTVPQIDHSTKTTRGWYMYVTAATGSNFGTAKLTSAQLPPTG
TSCEVRFWYYSYGNSTTTSTLDVYFIEGPIPKTRMLQIRNINSNKWQQGIAYMGRRIEKF
RLSFEGDRDFLGSSYMAIDDISMFECSLPQPQISCLSNQFQCANKVCVGADQVCDFQDDC
GDNSDEKNCAAYNGCNFEKSFCDWSQVYGSDNFNWERRSGTTLTFNTGPSRDHTSGTVTG
YYAFIDAFFRSQGQKAQLKSKWFQPDITGKCKIRLWYHMLGDGIGSLNVYVVPNTGKLIK
IWSRSGAAGDVWLKMEAPAVSSRYFYFVIEAVRGATIRGDIAIDDVTFTQNCQYATGTIP
THVTGPIPSVAPTPIPRCATWQTKNCGACTFEKGQCGWRDASFGGISKWARETAGHGQSI
NGPLLDHTTNSGNGYYMYTNARGGSFFTDSKIASPMLPAAYDTCTINFWYNRTLSSALYL
YVVQNGSSSRIWRSPFISSTGRPLWLNTTVGIGHRRAGFKLEFRISGSSFSTSIGAAAID
DISFNSCNFPQSAPCYSGNFQCSNGRCISPSLSCDYGNDCGDFSDEQGCAATLPWTCNFE
SSTCGFVQSKKDSFDWSRSSGGTFSSLSGPSFDHTLGTRLGYYMFFSARSNSANKTAQMT
LTQTFGTPSATCQMRFWYHLYGPDIGALNVYAQTAFQGPLIKQFSVVGNQGDQWKKASIT
FNVNKPFQVVFEAVNGKYFWGDIAIDDISFTTSCSKVNTPLPVAPQTDPGCSTGQKKCNN
GNCIQSTKWCDFIQDCTDGSDEKGCPNKCTFENGMCGWTSPLEYGEIQWARNSGGTPTSL
TGPTTDHTTGSGYYMYVEADNGTFSANAYLLSPLFNNPAPSCTLSFWYHMYGFDIGSLSV
DLITPSGTKQIWTKSNGQGNSWKQASNLKISSCTTAFQLSFKGSTDFFGSAGDIAVDDIL
LNGCAKSSSAASCPSGQNQCADKLNCYPASATCDFNNDCCDGTDEKLCAGYTMCNFEKSL
CGWTQLKSDNFDWTKHSGTTISSGTGPVADHTTGTSSGVYYYIETSFPRTVNQTAMLGSP
TLKSPSSTCAMRFWYSMNGPSVGSLRISTRTSFTAPLVQQWSLSGNQGPLWQKAIVNLPA
SSNPYQIVITGVVGSSFQGDIAIDDISFTPGCQFGGSIPGQPTIKPTQPGSCTNKFKCAS
GTVCVAWNKVCDWVNDCADGSDEANCGACTFEKGQCGWQNTFTDNFNWTRHQGRTPSLTT
GPSYDHTTFSSRGWYMYTEVTGGRIGNRADLSGPLIQKSPASCLLTFYLHMYGRNIGSLA
LYMFNSRGQRIAQLYGITGNQGNFWRRVQVTLGRRNYTYRLQFEAKRGAGFQGDIALDDI
TYSQCTVPTTCSLPASSRFVCPRGNCISNDQQCDFSQDCLDASDEANCNAYQQRCNFQTG
FCGWTNLHDDDFDWSTKNGPASTADTGPYRDHTLGTYAGNYALADSSRRNNGDVARLASM
PIAPTNSSSNCHLRFWYNMYGKTVRYLRVRTRTSIGGIYTTKFSRYGSIGSSWMRKSISL
TSSQAFQVVFEATVGSGFTGDIAIDDISLTPGCKPYSGSLPVTKTATPTPATTSTPTIRV
PNTCTSSQFGCYTSGSCIPKSKVCDFVADCLDGSDEWTCPSNCTFEKNLCGMTITPINDP
RYTFKWQYAMAHDAAEKQSLAVDHTTGTGKGHYVFYGGKIPPANPSLGVPYNNLETNLTT
GWYKHSDATCLMQFWYYYYGNVIGLMKVEILNQGDAKPSIIWETPGFMYNTWRNASVGIG
ARTKPFQIIFHGIHINAFDGAAAIDDVSFVGCAYPKPQTTCRIGFFQCKRRSCISSDQVC
DMTNDCGDNSDETNCKGYTQCNFEKSDCSYLMQDLTGDQMNWTRNAGPTFSIWTGPSRDH
TLGTYQGYYYYLEVSAQQYGKTANLLTPVFDLTTISTCKMILYYHMNGDTVGSLAILAKT
TRNGTAQQLFIKRGSQGDIWQRAVVTLPRGQLTQLVIQGTVGDSFYGDIAIDDVSFSPSC
NKTTQQLPYAPPPPSGIPPTTAVPHTCNLNSQFNCRSSGRCIYLSQVCDFRQDCADNSDE
VACIQPTCTFEKGMCGWLPQSTNGVFTRPNSTSPKFRWERHTGATHTGRTGPSVDHTLGT
SQGYYVYTDASNGRFTDTALLTSPIIGGTGSQCIISFWYHMYGTSVGTLSLVAKQGTTTT
STLWSRFGNQGNSWRQVTIKVGQRRNFQLQFTGRRGLLYNGDMAIDDVTLSNCMQPVRAP
TCPTSSFTCGNGYCVQPQYVCDYANDCGGLQDETTAACNKSAIGRCGFEADECYFYLDPS
GKNYWDRRSASFIFNGPTGDVNTASTQGHFLNLNSYFPAQTGDISRIASQPFKPAASSAN
CYLRFYYFMTPAINGGSLNVYIRGNSSVLGMRQIFSVSNTTVSYWKRVAVKITSSAAYQV
IFEGVVGSRYSSRIGIDGVSFTSGCQFGGNIQIPGINVRPPNSGFPTSTCTGSSNFGCKN
GKCIPRTSVCNFNNDCGDGSDEINCGSNCTFDKGACGWYNAGFGTRRNWTLAVAATAGRR
APPIDHTTNSSSGSYMFMPATSTSFLSFNRDVGILESALYKGSGPACTMSLWYTKYSFGT
YYYLAIYVRTSSNTVRIGYFTNGDFKGTTWQKVTVKIGIQQNFRILIGGSTGSSRLYGLA
VDDIKFQNCYSANRACTRNEFKCKTSGHCINKLWACDRQKDCPDGSDEAQCTYSYADCTF
DNGFCNYTNMQSGDFNWTRAMTTPSSFTGPTNDHTTPSTRTGYFAYTEASFPRKSFDTAY
LAGPILPASNGICWIKFWYNMYGTSMGTLSVTLRDIGLRQSLGTVWQKSGNQGIGWKRGN
ALINSAQPYRVVFQGRLGRSISSDMAIDDVVFTPACYVGGNPITPLPLVNNKCSNPSYAY
QCPINNKTVCIPNTWRCDGTVDCDNAMDEDRCGITTRPCKTTEFKCGTNGGCINSTMHCN
GVIDCFDGSDEAGCPKIEPQTANGGTIAAAVIGSLIAVALIGGMIFMYRTNRMGSITRFF
NKRSMSNPNYEPYTNDDKEPTLQNFSDTNELAASGSGQTAVSNPLYDGKEEADIYQ
Download sequence
Identical sequences B3S5U1
XP_002115596.1.101920 jgi|Triad1|59475|fgeneshTA2_pg.C_scaffold_11000053 10228.JGI59475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]