SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI60020 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI60020
Domain Number 1 Region: 5-84
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000696
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI60020
Sequence length 200
Comment (Trichoplax adhaerens)
Sequence
MDRKVYVAKFDYQNPYDGEELNMLSFQQGDRFLYVDHLTDEWVALKRIDTKEIGLAPSNY
VETVDGDSRKKGKLKAKTRSLSEGWHADPNHIDLTKNSELIARDISIGSKAGDLVEKPPE
WKKMVLSRQRRVHSLDDDNIDLELSAKLNAMAKKVDELSISVRITSRLILSPKYDVTCNS
VGMKIPRSSGYQGDSSFSML
Download sequence
Identical sequences B3S732
10228.JGI60020 jgi|Triad1|60020|fgeneshTA2_pg.C_scaffold_13000082 XP_002116100.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]