SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI60169 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10228.JGI60169
Domain Number - Region: 8-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0212
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI60169
Sequence length 187
Comment (Trichoplax adhaerens)
Sequence
MDVDYLKKNVSDALAEGLKEVVEKRPGDPIEFLGHWLIKYRQNQLDNQKIQNIILAGDQD
KELEEEEKIRQEILEIEREEERKRKIQEEILRLEKAREEARKREEAELAASIQEARITNA
DLVDKKEEEKVEVPQSPIIIGDGEEEERDDDDQSRGSSRSVADSRDGEERPSTVDKESEI
DPEAGKD
Download sequence
Identical sequences B3S7H7
jgi|Triad1|60169|fgeneshTA2_pg.C_scaffold_14000053 10228.JGI60169 XP_002116167.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]