SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI60905 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10228.JGI60905
Domain Number - Region: 129-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00411
Family MAM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI60905
Sequence length 486
Comment (Trichoplax adhaerens)
Sequence
MAVVNQALVVLLVCIFLTHCLASEISIYQKSDIKKDCPKNCLCRSSEIICTRLEEKFAVI
PNDVHRIILEQELECSNQNIKQLAKLSNQRHIQLIGYCIQNDLRNKIPLNKVLTVSNRDR
RVVGDSFIGCYFTDGFCSWTQSGNRPFQRQITSVGNFPLYAGPYIYFFKSSSDGLRTYEA
ILTTPSLILKKNANFSYVTYTAIARTNFLNSFSFSYAKGNSYFVLRTPSLMLDGWWHGYR
SSDFYETSAFRLRIYAETRWQSHSNGNFGLDNILIHNVELAGNSTFATVGPIVAVLSAVF
VVIVIIYKRQIWRRLRNTSQVQQQNNNVALKNVDNHNYPLTNSTFNMGSQATHGQNSISM
PNPSLPSQIPSGTSTEVATYSQNLIPMPNPSLSSQTLSTFSTGPITSRFDDKNDNFTSMK
VDNHNYLSTSSAFNADSQATYNQNSIPMPSPSFTSPALSGTLEGGVTSQAGHSDIPPDYA
KVVSTS
Download sequence
Identical sequences B3S9H1
10228.JGI60905 XP_002116850.1.101920 jgi|Triad1|60905|fgeneshTA2_pg.C_scaffold_18000095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]