SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI61380 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI61380
Domain Number 1 Region: 11-248
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.88e-80
Family Calponin-homology domain, CH-domain 0.0000186
Further Details:      
 
Domain Number 2 Region: 270-390
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-26
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 3 Region: 1229-1382
Classification Level Classification E-value
Superfamily Spectrin repeat 3.09e-24
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 4 Region: 1444-1587
Classification Level Classification E-value
Superfamily Spectrin repeat 6.24e-21
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 5 Region: 401-499
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-19
Family Spectrin repeat 0.00069
Further Details:      
 
Domain Number 6 Region: 577-716
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-18
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 7 Region: 2407-2497
Classification Level Classification E-value
Superfamily PH domain-like 3.5e-16
Family Pleckstrin-homology domain (PH domain) 0.00048
Further Details:      
 
Domain Number 8 Region: 792-927
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000196
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 9 Region: 879-1032
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000209
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 10 Region: 1725-1848
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000281
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 11 Region: 1006-1143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000038
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 718-828
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000023
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 13 Region: 468-576
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000936
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 14 Region: 1848-1986
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000804
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 15 Region: 1631-1714
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000157
Family Spectrin repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI61380
Sequence length 2526
Comment (Trichoplax adhaerens)
Sequence
MSQNNDEARAGMFEKSRKALAGERENVQKKTFTKWVNSHIAKVHLEVKDLYEDLKDGIII
LRLLEVLSGERVGKITRGKMRIQRVQNINLSLTYLQKKNVKLENIGANDIIDSNHTITLG
LIWIIILRFQIQGIQIDEEDGGESREKRSAKESLLLWCKIKTQGYKNVKINNFTTSWKDG
LAFNALIHRHRPDLVNYDNLQSKEDIKNLQSAFRIAEENFGVMPLLDAEDVVDYADEKSI
ITYVASYYQIFSKMRAEDVVERRVGKVMNKVMENARLIREYETLSTTLLKWISITITRLS
ERQFNNSLLGVQRQLTEFNTYRIVEKPPKFSEKGDIEEKLFNLQSQMRANNQKGYTPEES
KTVRNINKAWGELEKAEHETELALRQEIMRQERLEQLATSFDRKARLRFQWITDNLRLIS
DEDFGSTLTAVEASKKKHEAIVADVTTYQRRVQALNDLHGELERENYHEIQRITEKRDDV
FETWKELLEALKYRRSKLDLHIQLQILLSKISSWKNSIAEIKAGFQSEDCGRELADVTNL
LQQYNILETDFNTNQEVIMHTVADAKDFVEALDDADEDVSREVNDAVEEIQEIITEVNML
AQTRRAQLEHAQRLFNFFTYVDEELNWIQQIERSLTHTDLTTIKEYASVALVARRHRAIA
SDIDGHEAVIEQILDNGQEILATRNENAEEVLANMDELQTLWSNLKESVAIRSKRITEIE
ALGQFLLEASMIESWITLHSSLMSVDVHCNEDSGLRSILKTHQNLQEEIKAYQSQIETLE
ASAEDLAEIDKASDDVVVRLFTIKKNYQQLLELVQKRHHRLMSLQQFFAFLSDVDTVVSL
ANDKIVILKSITLPNELNEAEIMMKRLEGIQADLDKNADRYHHVQEQSEELLESLEYNLD
EIEAMRDNCNETWNGAHTILKEKVDCLHCKIGFLKLCFDIDSTTTWITVITARLRENVPA
TTDSDATLKLQSELNAVERDSAAAKERMTAILDNYNELPDLEEDDRCQLDEKLQNLQSQW
GDLSDRIDRQRAIIGDCSDYQRLLIDIEDFLDWISKALQEIDQQSDHVPLKAADAEMAIK
VHEDLQAEIESHVQLASDINEKSLPYLDDENEDQQLKTKLTELNHNWQEFLDLYEKHKKV
LQERYEESIFYGNCRQIEGALLLQDMYVARTLSQIGANTNTKSRPTKRLKNLVRSVIIKE
KQKKISLYNLVEMLKHHKDHERSFETCAEKVDELKQFARRLSVKEHEDGDKLVTKAGALD
ERLEKNRRRFQQTQDELDKSYKYYKFTADCEGLRDWIDEKLKLTTDIDISDRSNVFGLLQ
KHNTFEAELVATKDQLDQVKETGENLMEVYPDLQNEIEENLDGLQKQWLALCQASAHQGG
KLKNLDYQRQVQLAANGFEDWINSVEVSLNNEDTGKDLITCDRLLAKQTEVENELANRKK
RLSELYNPDGEDDNEVKDQINSLINRIDEFDEPCKKRRQLINASRQRHQFSFKVDDELLW
IHEKKMLAMSEETGNNLSEIRSQNRMHQHLRNEISHHEPLFESIFQVADELMKVDPSLIE
DIQSKTDLLESEWVSLEDCCTNRDELLARYTKAFKLMFDLNEFQEWVNEKLAVIDSQDKP
KELNSAVDNIENIDEDFVNALEDQREHINEIYEEFCSLAQEKTELYQLLLRIYRFKREVD
DLNQWTQEHTLLAKSQDCGYDYEQLQVISKAFEKWVETSKIQASDRITKVHTEGNAIIEA
CPQKTETLQEWINSVDITWDEFLQQVEERRELLSKTRELYKYYFDAHDLLQELQFKEQSL
VNDLGFNLNTTSSLCRIHQNFQLEFVNFENQVSNIRAEAQRLVEESSEGEKVMKVKEDVD
KAWINLARRNEWRSYYLQQTQEVFKATVVVDDLIDWICDMYEEVNQVNNIDPPVDIDSCR
RSINDMFNSKEEISSYEDKFTHLRSQIDDLQNNENYCRNELEVQWKGVQNLYERLTLNWD
LHYKELALFLSVFQFEEDLKKGESWLAFQEDKSRKFEITEFEKYKLNGLDDKVELYEEKD
TLLRNQELSNHQVDKEYLSLLIKHQQLLHSSDGFELDGSAFQEEEQQVDDQEIVPKDTEN
QESEQLLIEDLEINPKAALNQETELRLIEDQEIIPEVYENRKAELRLIEDQGINPHVAEN
QEAELMPIEDQEINTQAAENLEGAPLVSLEISLSPAGSDISEDVDPNLQISDNSGYDKLT
FHVDPSAIDEHINDQINLEVNEEPPHGMDIALDSTVPNANVALDLNHKDEIEPDYKPHFE
FNQGINMDINSEPNMKAPDVELSAEGHESAYFIPHGNEMENQVPESQVREASEDLATAVS
APEAIIEATKPQYEEFTRIKKDPVHIKTEREKTMREVEEEAKPQDKPKEQPKEQLEDKPQ
DGAPLRLIGVIHRKHVMERKGRKSEKRSWDKLIAAVFGLELRFYKDRKHYDAKIQASHSP
ISIKKMKCQLASDYKKKKNVFRIALSDGAEFLVQTDDVGYYFQKGCNLAYLHLPVYYSQA
IDIIKL
Download sequence
Identical sequences B3SAU1
10228.JGI61380 jgi|Triad1|61380|fgeneshTA2_pg.C_scaffold_23000077 XP_002117373.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]