SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI62681 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10228.JGI62681
Domain Number - Region: 2-47
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0855
Family MAM domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI62681
Sequence length 113
Comment (Trichoplax adhaerens)
Sequence
MSNCKWQNPANGTSNTVRWTRNKGKTPTSNTGPNNDHTLGTPADMGRELAIYPYLAIQIE
FIHFLATAGSDGTMLTLTSRLGFTGYSITIPRFSALLGNLLRVLTRTVTFFKD
Download sequence
Identical sequences B3SEJ0
XP_002118659.1.101920 10228.JGI62681 jgi|Triad1|62681|fgeneshTA2_pg.C_scaffold_309000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]