SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI63704 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI63704
Domain Number 1 Region: 10-203
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-42
Family SPRY domain 0.00048
Further Details:      
 
Domain Number 2 Region: 193-226
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000405
Family SOCS box-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI63704
Sequence length 228
Comment (Trichoplax adhaerens)
Sequence
MVATCAIGPIQEAFPDNWTWNIDDKSPDVELCSRREGAYFYTDPVIDSTGTAAVRGSKGF
DRGLHYWEVTLCEPTFGSSVMVGVGTKKAKLRTNNYEYIDILGTDCESWGLNYKGYLFHN
GRPTKFTDTFYAGTTIGVLLDMNVGKLSYFKNGSFLGTAFDDLLDINSELYPMIASTAAE
SEMQLGIRGSKFVSLEDLCRRTVRRYVDYANIDKLCLPQPIRNELKVL
Download sequence
Identical sequences B3RMJ7
jgi|Triad1|63704|estExt_fgeneshTA2_pg.C_21115 XP_002109695.1.101920 10228.JGI63704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]