SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI9323 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI9323
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily Kringle-like 1.18e-24
Family Kringle modules 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI9323
Sequence length 74
Comment (Trichoplax adhaerens)
Sequence
CFSGNGHYYRGGVAKTKYGHACTTWKSTSYTKDKFPEADLTNNFCRNPDSSLARPWCFTK
DSPNRRQVCDISKC
Download sequence
Identical sequences B3S9I4
jgi|Triad1|9323|gw1.18.185.1 10228.JGI9323 XP_002116903.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]