SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 103690.all5056 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.all5056
Domain Number 1 Region: 10-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-24
Family ArsR-like transcriptional regulators 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 103690.all5056
Sequence length 114
Comment (Nostoc sp)
Sequence
MKQALPVSQEVVQQVAEYFSLLSEPMRLRLLHLLRDEEKCVQELVDATQTSQANVSKHLK
VMWQAGILSRRSEGTSAYYRVEDEMIFELCNRVCDRLATRLEQQARSFRVLNKN
Download sequence
Identical sequences A0A1Z4KNX7 Q9AIS2
103690.all5056 gi|17232548|ref|NP_489096.1| WP_010999182.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]