SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 103690.alr5300 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.alr5300
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.01e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000657
Further Details:      
 
Domain Number 2 Region: 67-139
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 8.9e-28
Family Ribosomal protein L11, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 103690.alr5300
Sequence length 141
Comment (Nostoc sp)
Sequence
MAKKVVAVIKLALNAGKANPAPPVGPALGQHGVNIMMFCKEYNAKTADQAGMVIPVEISV
YEDRSFTFVLKTPPASVLIRKAAKIERGSNEPNKKKVGTITTAQLREIAQTKLPDLNAND
IDAAMKIVAGTARNMGVTVTD
Download sequence
Identical sequences A0A1W5CGX1 A0A1Z4KPQ5 Q3MA19 Q8YLJ8
103690.alr5300 240292.Ava_2552 gi|75908766|ref|YP_323062.1| gi|17232792|ref|NP_489340.1| WP_010999424.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]