SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 103690.alr7097 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  103690.alr7097
Domain Number - Region: 5-100
Classification Level Classification E-value
Superfamily Tropomyosin 0.00288
Family Tropomyosin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 103690.alr7097
Sequence length 107
Comment (Nostoc sp)
Sequence
MTDTPSNRLDRIEAILDRVASQQQLNTQAIAQLTTKLDNLSDNVNDLTSNVNSVLARDAI
LNDVLLELRDSHEQHQQNFEEHQRTTNAALNQLGAILVQLTRIDPQN
Download sequence
Identical sequences A0A1Z4KUM0 Q8YL38
WP_010999657.1.33676 103690.alr7097 gi|17233113|ref|NP_490203.1|NC_003276 gi|17233113|ref|NP_490203.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]