SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI102759 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI102759
Domain Number - Region: 76-122
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0113
Family Xylanase/endoglucanase 11/12 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI102759
Sequence length 307
Comment (Postia placenta MAD 698)
Sequence
MLSAFKIKPFDLEPTFASWPDAPRFIGNAKKDPLVSDWLAQIKAGCIERKIPRDYWHKVG
QHYLGPKAKARLDNVKLVMKNMHGGKYKWNWKTFKTAMRNMGWDIDSSKTEAIKVQSKPS
GLWWIVGRGGDSAPQEEASASSKPIRPPLKSKSASEVITTKSLPAPRRSATMSSIDTMSS
IATSMFSRTPSNQSSAISTLPITTPSEAPGDTLTTIAHAPLWLINACQSLDFLTNEHPKA
MTALSAVLITVGSLPALPAISAGAGPAFLATSTAHALGSIAVGLGTWLKSQSDGQVQVTG
PPTPPKS
Download sequence
Identical sequences B8PJB9
XP_002475780.1.31404 104341.JGI102759 jgi|Pospl1|102759|fgenesh3_pg.171__3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]