SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI103046 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI103046
Domain Number - Region: 109-174
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00998
Family LIM domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI103046
Sequence length 231
Comment (Postia placenta MAD 698)
Sequence
MAAVKKDALQAKQNDDLPPRQRRRWNAEAKAAAAVEKRLRPARVDFKAKKILHGNLRRRW
HKEHFPQQNEVVTMGKRSPKLRCCQNICLKRKSRLIAAKELAHCLTIASFHVGQKTTSRQ
LWSHWGCLKQGQLHFHRRVDQNDRVHVSGLGGFNRLSDKQKEVITATIVAADQPGPPPPD
PKSAAGIARKAKKAKARRESKQKRSDLAKLGECLATVQRRLGKKTFVSDSI
Download sequence
Identical sequences B8PDJ8
XP_002473753.1.31404 jgi|Pospl1|103046|fgenesh3_pg.93__1 104341.JGI103046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]