SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI106414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI106414
Domain Number - Region: 11-80
Classification Level Classification E-value
Superfamily POZ domain 0.00863
Family BTB/POZ domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI106414
Sequence length 297
Comment (Postia placenta MAD 698)
Sequence
MSNVFSSSKQSNIPWTLESALAASVSDGSFADVELSLFSRRLAAGKVGHPRPVYANSAVL
KRASSYFHGLLEGGFVEGDVYAGSPSFPTSTDEYDYESDSDLEDDGIDETDVENEREVAR
GSEDAPPSPQAGDETRKGKEIARPHSTPARETSRPGLRRVMIKNSAFNTNDAILHAGITF
FEDHCMDTSALPPLQRKLELISAGDFTHGVPVVLSLFNACISINKKKKTSPSASKPPKAP
EHPDTGSPAESEKLPKGPTSGGVGGGLFATSSGTSSQGGSVFGQSNGAFGQKAKSRS
Download sequence
Identical sequences A0A1X6N450 B8PEP1
XP_002474162.1.31404 104341.JGI106414 jgi|Pospl1|106414|fgenesh3_pg.104__17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]