SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI106782 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI106782
Domain Number 1 Region: 17-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000137
Family Glutathione S-transferase (GST), N-terminal domain 0.0097
Further Details:      
 
Weak hits

Sequence:  104341.JGI106782
Domain Number - Region: 162-243
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000156
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI106782
Sequence length 256
Comment (Postia placenta MAD 698)
Sequence
MPSHLITLYDIQCKLDSTAWSPHTWRTRIILNYKKLPYQTTWMPLPDVQTVLPAVGVLPT
RTAVPHYTVPAIVDELEGSPAVVMSDSGLIADYLERTYPEPSIYHGAKALQMEHVGAVSQ
HVLSRMGFMVFPNTPRLLEGREREYYLNTRKGIFGVELDDMFPEERQEEMWANLKEGFAA
LGAYIDGIEHSEQWFFSKTSEPGYADFVLGATMIWFKLSGPEKGWERISEWDGGKWARFF
RNLEPYTASSVIDSSS
Download sequence
Identical sequences B8PPL1
104341.JGI106782 XP_002477616.1.31404 jgi|Pospl1|106782|fgenesh3_pg.1151__1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]