SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI107131 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI107131
Domain Number 1 Region: 133-235
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.29e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0053
Further Details:      
 
Weak hits

Sequence:  104341.JGI107131
Domain Number - Region: 57-99
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 0.0511
Family GTP cyclohydrolase I 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI107131
Sequence length 387
Comment (Postia placenta MAD 698)
Sequence
MADTTEAAPAINKNKRHRKEKPWDTDDIDQWAIQPFQVEDNKSGTFTEESSFATLFPKYR
ERYLREVWSAVTQALEPHGIACTLDLIHGSMSVRTTRKTYDPYVILKARDMIKLLARGVA
IGQAVKILDDTVACDIIKIGNIVRNKERFVKRRQRIIGPDGSTLKAIELLTQCYVLVQGS
TVSVMGPYKGLKEVRRIILDCMKNIHPIYRIKELMIKRELAKDPQLVNESWDRFLPKFRR
HHLKTSEKTARKNERTQEKNGARKAAGLEPTGSEKDQPAKKVYTPFPPPQMPRKVDLQLE
SGEYFLKAHEKQDREARKRKQKQEQVTEERRAKRAEAFVAPVEEIVPTVEEKRKRRREKE
TEDLEEETGKHKKAKRKKRLHSEGNSE
Download sequence
Identical sequences jgi|Pospl1|107131|estExt_fgenesh3_pm.C_180006 104341.JGI107131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]