SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI109506 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI109506
Domain Number 1 Region: 52-257
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-73
Family Peptidase A4 0.000000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI109506
Sequence length 258
Comment (Postia placenta MAD 698)
Sequence
MLSAGLLSCILLAASAVARPSGLAGRIARRRAGSHLSQPLQRSELISDQSNVEYSSNWAG
AVYAEGDGTYTAVTGTFVVPTPSAPSGGSGTYSAAAWVGIDGDTCDNAILQTGVDFTVDG
GEVSYDAWYEWYPDYAYDFSGISISAGDTIKTTVTATSTTSGTAVIENVSTGQTVTQSLT
SSYALCEENAEWIVEDYEENGGLVSFADFGTVTFTDAVATTSSGTQGPSGATLIDIEQNG
NVLTSASVSSSEVVVKYT
Download sequence
Identical sequences A0A1X6N1L7
jgi|Pospl1|109506|estExt_Genewise1Plus.C_1680010 104341.JGI109506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]