SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI112658 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI112658
Domain Number 1 Region: 20-242
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-58
Family Xylanase/endoglucanase 11/12 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI112658
Sequence length 243
Comment (Postia placenta MAD 698)
Sequence
MKLLASFVLAALAACARSQTTLTGQYTCATSGNYELCQDQWGSANGVGSQNSTLVSTSGN
TISWTTTYTWANNENDVKTFANVLQTTYQGITLSTITSAPTSWTWEYESSSSGLRADVAY
DIWFGSAAGDAGSSTSTYEIMIWLSGEGGIQPVGSESTSGISLAGYTWNLWAGENTNWET
YSFVSASGNINDFSGDLTDFFNYLYDNEGVSDSQILQAIQTGTEAFTGTATLNVESFSVS
VET
Download sequence
Identical sequences B8PEZ4
XP_002474242.1.31404 jgi|Pospl1|112658|estExt_Genewise1Plus.C_1070028 104341.JGI112658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]