SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI112669 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI112669
Domain Number 1 Region: 8-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.02e-47
Family Xylanase/endoglucanase 11/12 0.0000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI112669
Sequence length 224
Comment (Postia placenta MAD 698)
Sequence
MLKPSFQDNGTGSQNATLYSASGDSISWSTTYTWSGGQYDVKSYSSVNQLSANGMLLSDI
TSAPTSWDWEYQEISSDLVADVSYDIWVGTTPDDPGSNTTTFEIMIWVSTEGGAGPLGSQ
VASDISVGGYTWNLYEGPNTYWETISFVTAEGNLNNFSSDLKDFFDYLVANYGVSDSDVS
DSNGSDVSSWLSSEQYLQAVESGTEPFTGSATLYTSSFYVVVNT
Download sequence
Identical sequences jgi|Pospl1|112669|estExt_Genewise1Plus.C_1070058 104341.JGI112669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]