SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI113926 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI113926
Domain Number 1 Region: 73-313
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-47
Family Glycosyl hydrolases family 16 0.00039
Further Details:      
 
Domain Number 2 Region: 38-70
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.00000838
Family Hevein-like agglutinin (lectin) domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI113926
Sequence length 379
Comment (Postia placenta MAD 698)
Sequence
MLLSSCSRAAGAMLSALPLLALLSALPGAAAQGETCNTTTLCSSANPCCSPYGYCGSGAN
FCFGGCDPLASHSLTSCEPEPVCQNANISFNSFDRILMNQSLYDGNASRWDFILNEGNIQ
NTSAGELVMLLTESNGGTRLSSTRYVHYGQMTARLKTGRWGGVVTAFITMSDIKDEIDWE
FPGNETSQGQTNYFWQGVIPAQTAGQTTGNLTDTFSNYHDYTIDWQPDQLQWLVDGNVVR
TLLRSSVTDNSTGVSRYPNTPSRIELSIWPAGISSEPQGTVEWAGGYINWNDSDYKSAGH
FYAYVDSVSITCNDPTPASSNVTSYVYGSNSTGNTPSISFSNKSTIVTTGAAAPATGSPR
SAWAIFAGVLGAVALVGAF
Download sequence
Identical sequences B8PFH8
jgi|Pospl1|113926|estExt_Genewise1Plus.C_1130023 XP_002474442.1.31404 104341.JGI113926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]