SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI115877 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI115877
Domain Number 1 Region: 9-178
Classification Level Classification E-value
Superfamily PRTase-like 3.41e-46
Family Phosphoribosyltransferases (PRTases) 0.00000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI115877
Sequence length 183
Comment (Postia placenta MAD 698)
Sequence
MSDVEHLRSLLKAHPDFPKKGIVFLDIFPILRDPVAFETLITHFVYRLTSHTIPNSPSKK
VDVVVGLDARGFLFGPIIALRLGAAFVPVRKRGKLPGECVTATYEKEYGTDSFEMQADAI
QPGQNVIVIDDLIATGGSAKAAGELVTKRGGKVLEYLFVIELTFLKGAQQLNAPVYSMVK
ADD
Download sequence
Identical sequences 104341.JGI115877 jgi|Pospl1|115877|estExt_Genewise1Plus.C_1550037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]