SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI117965 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI117965
Domain Number 1 Region: 193-322,389-553
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.95e-39
Family Glycosyl hydrolases family 16 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI117965
Sequence length 605
Comment (Postia placenta MAD 698)
Sequence
MTSLGPNSQRRYIQPDSPSTTNLLSPQSRPGVQDAPGPARSLRSVASDASLAESSRYAPS
TPHSIPPSISDKFSLSPDPSSWGADLSPGHPEDDDFLHNPDPRRDRKNDKGGNIFTYRGI
TNLGCLFILAVGIVTLFAGYPLISYFTKHKASTAGGFNLGGINASGQIPSMAGNYAMVDK
HTPDSALKKADWMSGKEWTLIFSDEFDVDGRTFWPGDDPYWEAVNLHYWETNNLEWLDPT
AITTSNGSLHITMTDQPKNNLNYTSGMMTTWNKFCFTGGMVEVSVRLPGTNNIVGLWPAV
WTMGNLGRAGYGASLEGMWPYTYDACDVGTAPNQTKNGLPLMATINGDPSNGDVLSYLPG
QRLSRCTCPGSSHPGPMHSDGTYVGRAAPEIDIFEALISDGRGQVSQSAQWAPFNYKYTW
DNTSSTYSIGNESITELNPYKGGVYQEASSALTWTDQTAYQLSGGGYSIYGIQYQPGFDD
AYITWVANNQVAWTVEAAGMGADTVVEISARPVPQEPMYLIMNLGISQNFGPVDTTGLIF
PSIMSIDYIRVYQDPDNINYGCDPDDFPTAAYINEYIDAYTNPNLTTWHGDYGQPIPGNS
FLGQC
Download sequence
Identical sequences 104341.JGI117965 jgi|Pospl1|117965|estExt_Genewise1.C_480186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]