SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI119218 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI119218
Domain Number 1 Region: 109-640
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.95e-154
Family Calponin-homology domain, CH-domain 0.0000000000122
Further Details:      
 
Domain Number 2 Region: 7-89,133-153
Classification Level Classification E-value
Superfamily EF-hand 0.0000000745
Family Polcalcin 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI119218
Sequence length 646
Comment (Postia placenta MAD 698)
Sequence
MDALRLRKKFPEVSQDEMFDFISRFNALHTDTPGRVDKASVLQALQANGESYDRVRETLK
HVSVDASGKVELEDWVELNVKLKTEAPALASHKGKVTVQGSNANVSHTINEDERAEFTNH
INSVLENDSDVGSRLPIPTNTMQLFDECRDGLILCKLINDSVPETIDPRVLNKPTARKPL
NAFQMTENNNIVITSAKAIGCSVVNIGPTDIAEGREHLILGLIWQVIRRGLLAQVDIKIH
PELYRLCEDGETIEDLLRLTPDQILLRWFNYHLKQAGWKRRVNNFSRDVSDAENYTVLLN
QLKPEQCSLAPLQTRDVRQRAEQVLQNADAIGCRKYLAVSSLVSGNPRLNLAFVANLFNN
HPGLAPLDEQEAKDYGVVEDFDAEGEREARVFTLWLNSLGVEPGVFNLFENLKDGLVILQ
AFDKISPGSVVWRRVSKPKAGAEAPTNYATAEGEEEEDIGVTPNQSKLSRFKQVENCNYS
IDLAKQSGMHMVGIQGADITDGTKTLVLGLVWQLMRMSITKTLTAISGKGRPISDTEILK
WANTTAQKAKPGVKPIRSFKDPSLTTGLFFLDLLEALRPGIVDPTLVIQVSDAGPYEDRR
QNAKLAISIARKMNALIFLVPEDIVDIRPRLIMTFVGSLMAIGSQQ
Download sequence
Identical sequences A0A1X6N3Q3
104341.JGI119218 jgi|Pospl1|119218|estExt_Genewise1.C_1930027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]