SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI125346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI125346
Domain Number 1 Region: 73-313
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.02e-47
Family Glycosyl hydrolases family 16 0.00039
Further Details:      
 
Domain Number 2 Region: 38-70
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.0000072
Family Hevein-like agglutinin (lectin) domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI125346
Sequence length 339
Comment (Postia placenta MAD 698)
Sequence
MLLSSCSRAVGAMLSALPLLALLSALPGAAAQGETCNTTTLCSSANPCCSPYGYCGSGAN
FCFGGCDPLASHSLTSCEPEPVCQNANISFNSFDRILMNQSLYDGNASRWDFILNEGNIQ
NTSAGELVMLLTESNGGTRLSSTRYVHYGQMTARLKTGRWGGVVTAFITMSDIKDEIDWE
FPGNETSQGQTNYFWQGVIPAQTAGQTTGNLTDTFSNYHDYTIDWQPDQLQWLVDGNVVR
TLLRSSVTDNSTGVSRYPNTPSRIELSIWPAGISSEPQGTVEWAGGYINWNDSDYKSAGH
FYAYVDSVSITCNDATPASSNVTSYVYGSNSTGNTPSIS
Download sequence
Identical sequences B8P279
jgi|Pospl1|125346|estExt_Genewise1.C_100084 104341.JGI125346 XP_002469743.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]