SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI130016 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI130016
Domain Number 1 Region: 6-134
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000278
Family Ricin B-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI130016
Sequence length 135
Comment (Postia placenta MAD 698)
Sequence
MSRPSAGTYIIYNRVLSPKGEKLAFTFTGQNKTQTVTPLSNDETQKWIIKDYNSNTQTIS
PESNANLQAAWGDQGVTVLPAGAYVWVIKSTDSGYTIQDGKQTVYWGVADAVDNANVTIT
AGTGNEKQRWIFHQA
Download sequence
Identical sequences A0A1X6N6A9
jgi|Pospl1|130016|estExt_fgenesh3_pg.C_1740011 104341.JGI130016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]