SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI25159 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI25159
Domain Number 1 Region: 109-243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000174
Family SPRY domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI25159
Sequence length 257
Comment (Postia placenta MAD 698)
Sequence
PPAWEPAPEPSHPEPLYNDATIDSFERANTFCRENPVNMPMQLLPADLERISSMDCGAWR
LEPPLGKSFCGDIYNDYKRSTGRVVRVATYNRCEDTCVMSDLPLMAGLYDIRGKVGFYYE
VTIRKMNGVIAIGTACKPHPEWRFPGWDRLSAGLHLDDLRKYFEDSLGGRDYVSNLTRIQ
PGDVIGCGYYFATGALFFTYNGQRLPDAFNGIYMPRTANDVYAAIGVEGENEFEVNFGSD
YFKWVEGGEWQWKVGGH
Download sequence
Identical sequences B8P0L0
104341.JGI25159 104341.JGI25234 jgi|Pospl1|25159|gw1.5.117.1 jgi|Pospl1|25234|gw1.119.32.1 XP_002469257.1.31404 XP_002474594.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]