SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI27700 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI27700
Domain Number - Region: 9-62
Classification Level Classification E-value
Superfamily POZ domain 0.000165
Family BTB/POZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI27700
Sequence length 111
Comment (Postia placenta MAD 698)
Sequence
NEVVQLSETAAALELLFQYMYRQRQPDLLCVPFETLAQLAEAAEKYQVFSAIEVCKMYMM
TSIPLHPVEVLAYAGRHDYATLCDEAAPLTINASVEDMSKHLGPATFIIWV
Download sequence
Identical sequences B8PDE1
XP_002473699.1.31404 jgi|Pospl1|27700|gw1.90.26.1 104341.JGI27700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]