SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI36161 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI36161
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily POZ domain 0.00000029
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI36161
Sequence length 165
Comment (Postia placenta MAD 698)
Sequence
HTQVQNTLFKIHRYFLLRESELFGTLFDLPAGDMGAEGQTDLTALPLHDVTCREFESLLD
FLYKSMHDDAKLTLPQWIDVLSISMRYICDKIRDRAIREIHQHHPRINPIEKIVLALQFD
VPDWLAPSYEAICQRAHPLEIEEAQRLGIVISTQLARAREAIRQE
Download sequence
Identical sequences B8PK02
XP_002476014.1.31404 104341.JGI36161 jgi|Pospl1|36161|gw1.184.9.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]