SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI48794 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI48794
Domain Number - Region: 30-121
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0112
Family Calcium ATPase, transmembrane domain M 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI48794
Sequence length 125
Comment (Postia placenta MAD 698)
Sequence
MSTQPLLQRTAAKRIALPVRVEPKVSFANERTFLSWLHFTVVLGGLAVGLLNFGDQIGRI
SAAMFSVVAMAVMLYALYTYHWRANAIRTGGRGPYDDRFGPTILCIALLVAIVANFILRF
TQPDV
Download sequence
Identical sequences A0A1X6MV11 B8P317
jgi|Pospl1|48794|e_gw1.84.36.1 jgi|Pospl1|88265|fgenesh3_pm.14__9 104341.JGI48794 104341.JGI88265 XP_002470105.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]