SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI51209 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI51209
Domain Number 1 Region: 19-123
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000576
Family BTB/POZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI51209
Sequence length 154
Comment (Postia placenta MAD 698)
Sequence
MEKGKESVPSEASSPFDRTDADVILQSSDEVQFRVHRVILALASPVFADMFGLPPPRAPD
GTTMEAIQTVYITESSHVLRILLDMCYPVTNVQFSSLDDVHAVLKAAVKYDMSKVIALAY
RALSTFISKSAMRVYAIACQLGAEDVAREAAPHA
Download sequence
Identical sequences 104341.JGI51209 jgi|Pospl1|51209|e_gw1.5.151.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]