SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI53120 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI53120
Domain Number - Region: 27-75
Classification Level Classification E-value
Superfamily ARM repeat 0.00477
Family Armadillo repeat 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI53120
Sequence length 96
Comment (Postia placenta MAD 698)
Sequence
EDPEEKEGWEMVSMDGQMVGIKTSGLEEKCQAFETLVIYCSTLGVRFAPYLTQCLELVLP
SLRFYFHEGVREACAMYEFILSMACLYLTIASCMLG
Download sequence
Identical sequences 104341.JGI53120 jgi|Pospl1|53120|e_gw1.211.13.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]