SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI53931 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI53931
Domain Number 1 Region: 190-258,295-428
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.32e-28
Family Glycosyl hydrolases family 16 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI53931
Sequence length 429
Comment (Postia placenta MAD 698)
Sequence
MYLHVPLLLFLLANVVPSNANVFTRGSESITRAAKRARHNTIKRSSGLIRDLRLAYSGTL
VDQQADSPGKYYCVKVDTDETSSTNGTRSGSSSVASLGAKPSATATSSSAPAASSSAVAS
SPWKLKQSYEGNSFFAGWSFFTDTDPTGGTVDYIDGSAAESANLTGINSAGNAYLKVDTT
PVITSGYRRSVRITTDFTYTGALIVLDAVHMPTGCGTWPAFWSNGPNWPDGGEIDIVEGV
NDYTNDQVTLHTNTGCSLPTSNATVLAIAGDIVGSTDCSVSGTGDAGCGIRASQTNSFGA
AFNDIGGGVYTMQWDDTGVSVWYFTRSTIPADISAGAPQPSGWGMPIANFPASSCNPSQF
FYDHSAIFDTTLCGAWAGDGWTASGIPGQEQSCAQRTNTATCAEFVANNGAAFEQAYWEV
KSVKIYQTS
Download sequence
Identical sequences A0A1X6NHA2 B8P997
jgi|Pospl1|53931|e_gw1.53.32.1 104341.JGI53931 XP_002472273.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]