SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI54405 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI54405
Domain Number 1 Region: 35-162,195-303
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-24
Family Glycosyl hydrolases family 16 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI54405
Sequence length 322
Comment (Postia placenta MAD 698)
Sequence
MRTSDIFLTISSLVVGSLAGTYNIDKTYIGEDFLNTWTHEAISDPTHGRVDYVTQATALA
ENLTYANGDTLIMRADATTVLSASGPGRKSVRLQSQDSFGTHIVIFDVRHMPVGCGTWPA
AWETGPNWPANGEVDVVSTYVIEGVNDQGPNLVSLHVATTCSMPSSGRDMSGTAGSLNCD
VNTDGNSGCGVNNPTSNSFGHDFNNAGGGWYAMERTSDEVKVWFWSRQDSTVPGDVQSGA
DEVNTNNWNQPVAYFPSTDCDIGNEFGKNNNLIFDLTFCGDWAGGSSYAAAGCSGTCVDW
VNNHPSSFHDSYWDVAAVRVYT
Download sequence
Identical sequences A0A1X6ND60
104341.JGI54405 jgi|Pospl1|54405|e_gw1.72.112.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]