SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI62300 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI62300
Domain Number 1 Region: 31-159,190-233,266-292
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.77e-25
Family Glycosyl hydrolases family 16 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI62300
Sequence length 335
Comment (Postia placenta MAD 698)
Sequence
MRTCVALLALVPVLTRSASAQFVLADQFVGYNFFEGWTWETINDPTNGRVNYTDQAFARA
QNLSYATPTTFVMRADDTNVVPASARGRNSVRILSNKAYGDSVAILDLSHMPQGCATWPA
FWSLSATGPWPAGGEIDIIEGVNENVQNLVSLHTSPNCTMPPQRVESGTVTSTNCDANVN
YNQGCGVQGATGSYGVPFNAAGGGWYVMARTAEDGIRVWFWARGDPTVPPEVLYAPALGI
LGTTISPNPTWGAPVASFPMGPLCDYATHFNAHQFVFDLTFCGDWAGNDYTTTGCSGSCT
DLVNNDPEAFSESYWAVNSLRIYTRVESTPYPPYP
Download sequence
Identical sequences A0A1X6NC06 B8P0Y0
jgi|Pospl1|62300|e_gw1.6.92.1 104341.JGI62300 XP_002469319.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]