SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI63594 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI63594
Domain Number 1 Region: 46-110,141-281,319-335,366-389
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-56
Family Glycosyl hydrolases family 16 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI63594
Sequence length 391
Comment (Postia placenta MAD 698)
Sequence
MLTQEIEKPWIKEKDIYARLSWWLTWTIAFLGVAGGAVRCYFSWKDVPRVGNLCLVMEDD
FATFDLENTWTREVDMGGFGNGEFEMTTDSSNNSFVKDGKLYIVPTLTADVIGYDNVLNG
YTYNISGCTSTNLTSCGAVSNSTTGSVINPAMSARISTRNSHSIKYGKVEIVAKMPVGDW
LWPALWMLPVNETYGPWPASGEIDIVESRGNSINYAAQGRNVVRASLNWGPLSFLNGVAK
TYGWWSDRRSTYADGFHTYAVEWTPTFIRMYVDTRLDRMLQVSFNEPFFKRGDFPATVLN
GTQYIVTPDPWVNGTRNVAPFDQDFYLIMDVAVGGTNGWFPDGVGNKPWLDTSTLAMSNF
AKAQSTWSATWPEDIDQRAMIIDSVKMWQSC
Download sequence
Identical sequences A0A1X6N3F1 B8PMU3
104341.JGI63594 jgi|Pospl1|63594|e_gw1.286.3.1 XP_002476997.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]