SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI64431 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI64431
Domain Number 1 Region: 30-180
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.19e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0055
Further Details:      
 
Domain Number 2 Region: 195-285
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-19
Family Ypt/Rab-GAP domain of gyp1p 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI64431
Sequence length 320
Comment (Postia placenta MAD 698)
Sequence
AATAHSFNKILNQFKLSSKIRTIHDIEESVKKLRRLILVDGIPSADTSLRPRIWKILLRV
QDVSADTFLEYVARGPCEVREKIRNDTFRTLATDRGFKERVREDMLVRLLDAFVWRNYDS
ETHQFGFTYVQGMNVLAAPFLYTMPSELEAFFCFAKFIEESCPLYVQPTLEGVHRGLKAC
YNSCANTVLRLTLTQLLDRCLKIVDPELYAYLRSKNLSAEIYAFPSILTLCACTPPLDQV
LQLWDFLLAFGVHLNVLCVIAQLLLMRDEVMNSSSPMRLLRTFPPLEALPVIGIAVTLVR
DLPTDLYDELVRHPYAVQDQ
Download sequence
Identical sequences jgi|Pospl1|64431|e_gw1.54.50.1 104341.JGI64431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]