SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI95303 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI95303
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000282
Family Pepsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI95303
Sequence length 147
Comment (Postia placenta MAD 698)
Sequence
MTELAFVIGGITYPVDPLDLVAPFGWFTNGTVACGGTFVTVDNGDTSPTMVLGQTFLRNT
YALYNLNPTGNGNKNTTLPFVQLLSVTDAKEAAENYNAQNNARLEAYAAAHGFKYVAQSS
SQESQIKQIRGWMLLVGFMTFVHLIGL
Download sequence
Identical sequences B8PNT9
jgi|Pospl1|95303|fgenesh3_pg.489__1 XP_002477344.1.31404 104341.JGI95303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]