SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI96926 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI96926
Domain Number 1 Region: 197-292
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000106
Family Glycosyl hydrolases family 16 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI96926
Sequence length 345
Comment (Postia placenta MAD 698)
Sequence
MRRIASDDTQALASPSRGSMILYSLATGHDDADSLPEPPRLSDNHKSSSGEFVITLFYDS
KYPAGSSTRQSAFIPYAFDPWADAKNEPEDDDYLYAPGYGDDHASYRVPSWRGLLNVTLL
VSVITTLIALFICHPVVSFYRGDSYNRAINSNEAVNGTCQVKSIAKASTLFALRDVIDPD
TPQDARTRTGFEGQPYVLVFSDEFNTDGRSFPGDDPYWEAADLWYGATNDLEWYAPEQVT
TTGGALHITLEQAEPDAADSHTLGYQSGMLQSWNKFWFSGGYVEVALTLPGPDSDAQGYS
IRPPHSASSMLGSPPTFPPLPILPPVPGLSPIALSPRLHVVEGKD
Download sequence
Identical sequences B8PFW2
104341.JGI96926 XP_002474555.1.31404 jgi|Pospl1|96926|fgenesh3_pg.117__41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]