SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI98716 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI98716
Domain Number 1 Region: 20-155
Classification Level Classification E-value
Superfamily TPR-like 0.00000171
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI98716
Sequence length 189
Comment (Postia placenta MAD 698)
Sequence
MLAELDVPPWVTKTDMGAPLEALGRFYSREGNVEYAIPLYLQAIGLLVPLASSKKKATVE
ERCRGGQLMNNLAELSIRGEPTDAKRKQAEAWARQGLATIESTKALGKGSPEELMLCDEA
LAAVLFNLGSLLEMAGDTEQSRDLFQKSLDQAKNIKMREGIIQSQTALRRLDRASKRTST
PTQDDKSGL
Download sequence
Identical sequences B8PP01
XP_002477406.1.31404 jgi|Pospl1|98716|fgenesh3_pg.544__5 104341.JGI98716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]