SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI99040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI99040
Domain Number - Region: 3-28
Classification Level Classification E-value
Superfamily F-box domain 0.00196
Family F-box domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI99040
Sequence length 240
Comment (Postia placenta MAD 698)
Sequence
MAITDLPPELLVAVFSLLMAADLVNVKQLQYIIELELLGMSDNPPCGLPTSTKLHRLREL
ARSWRDMRFTPGISLPAAASRVYAFSAGVFAQVNSKGSIDVIQLPSLLMNREERRWTVKP
TDVLNDIEAIYLDPSQDLLVVVAPGLSITSAPEWRLHLLSLTGPGTPHPLTSEPCRTFGD
IYGFDSNFSMHIEGDILGFFLSPGFGSVRCICSWKSPSVVLDLPQCVIRVSGREPLHRAG
Download sequence
Identical sequences B8P6L6
104341.JGI99040 jgi|Pospl1|99040|fgenesh3_pg.34__46 XP_002471338.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]