SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 106370.Francci3_1630 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  106370.Francci3_1630
Domain Number 1 Region: 36-228
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.36e-42
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 106370.Francci3_1630
Sequence length 232
Comment (Frankia CcI3)
Sequence
MSDANGGDTSRTGYTEYTGKVTVGGPADVRTLPGLTITKVAVGPMNNNAYLLHCPVTGEQ
LLVDAANEADTLLRLVGDAGLATVVTSHRHDDHVQALADVVTTTGASTVAHPDDAPAIPV
PTARQVREGDEIAVGTAALRVIHLVGHTPGSIALLYDADPAAPHLFTGDCLFPGGPGNTF
GDEQAFTTLMDDLERKIFGPLPDTTWIYPGHGHDTTLGAERPHLAEWRARGW
Download sequence
Identical sequences A0A062WZI5 A0A1X1N464 A0A1X1Q023 Q2JCI6 W9D1E7
106370.Francci3_1630 gi|86740335|ref|YP_480735.1| WP_011436069.1.23478 WP_011436069.1.51677 WP_011436069.1.5445 WP_011436069.1.61086 WP_011436069.1.64980 WP_011436069.1.72223 WP_011436069.1.79022 WP_011436069.1.93808 WP_011436069.1.98991 WP_011436069.1.9943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]