SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 106370.Francci3_3112 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  106370.Francci3_3112
Domain Number 1 Region: 4-128
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-33
Family FUR-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 106370.Francci3_3112
Sequence length 146
Comment (Frankia CcI3)
Sequence
MNDQTDLRLTPQRMAVLAVLAAARDHPTAAEVHERVRTVSPGIGSATVYRTLALLVSAGR
ALELNLGDGTAARYDANTSRHDHVVCDGCRRAVDIDHPVLDGMMAQIACRSGFAITGYDL
RFRGLCPDCQANGSGPARGAAGTGQQ
Download sequence
Identical sequences A0A062X5P1 A0A1X1N3N6 Q2J8C3 W9D3W3
106370.Francci3_3112 WP_011437497.1.51677 WP_011437497.1.5445 WP_011437497.1.61086 WP_011437497.1.64980 WP_011437497.1.72223 WP_011437497.1.79022 WP_011437497.1.98991 WP_011437497.1.9943 gi|86741798|ref|YP_482198.1| 2005313779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]