SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 106370.Francci3_4353 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  106370.Francci3_4353
Domain Number 1 Region: 71-148
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 3.01e-16
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0018
Further Details:      
 
Domain Number 2 Region: 154-210
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 0.00000000000000471
Family Head domain of nucleotide exchange factor GrpE 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 106370.Francci3_4353
Sequence length 271
Comment (Frankia CcI3)
Sequence
MTSGQAADWWGSSRPDGRDEAEEPPVVVRDRRRIDPESGEVRPEAAAPPGPTATEVPPAG
VPAGEGDGELVASLRQQVTERTADLQRLKAEFDNYRRRVERDRQQIGEQATAKLLASLLS
TLDDIGRARDHGDLEGPFKAIAEALEAALEATGLERYGAKGDEFDPSVHEALMHSYRSDV
SGPTCVDVFRAGYLHAGKVLRPAQVSVAEPSGEVDEIVDQPVEAEVVAGAGEVPGSGPGQ
AGGPPDRPTSVPDDTGSVPGPDNGGPTVSAG
Download sequence
Identical sequences A0A062X4T7 Q2J4U3 W9D820
106370.Francci3_4353 WP_011438707.1.51677 WP_011438707.1.5445 WP_011438707.1.57996 WP_011438707.1.61086 WP_011438707.1.64980 WP_011438707.1.79022 WP_011438707.1.98991 WP_011438707.1.9943 gi|86743028|ref|YP_483428.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]