SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 107806.BU086 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  107806.BU086
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily L28p-like 1.81e-25
Family Ribosomal protein L28 0.0000715
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 107806.BU086
Sequence length 75
Comment (Buchnera sp)
Sequence
MSRICQITGKKRMIGNNRSHALNATKRKFLINIQYHRFWIADEKRFIKLHVSTNGMRYID
KKGIETVIRKINMKK
Download sequence
Identical sequences P57188
NP_239920.1.37072 107806.BU086 gi|15616708|ref|NP_239920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]