SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 110662.Syncc9605_1955 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  110662.Syncc9605_1955
Domain Number - Region: 54-117
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0173
Family Carboxypeptidase regulatory domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 110662.Syncc9605_1955
Sequence length 147
Comment (Synechococcus CC9605)
Sequence
MGTIDRPSMLRLLAPLLLLGSVLHGAVLAPAKAHQIESALQYLDGDLQLSSSFSNGEPTQ
GAVVRLLNADGTPGQELGRTDVEGRLSLDLSSVGNGTVDLQVDGGPGHRDYLELPVQDGE
VDLNEVVMFPFSLVMVGLLVSVRRRND
Download sequence
Identical sequences Q3AI86
110662.Syncc9605_1955 gi|78213472|ref|YP_382251.1| WP_011364905.1.53453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]