SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 114615.BRADO3089 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  114615.BRADO3089
Domain Number 1 Region: 14-129
Classification Level Classification E-value
Superfamily Translational machinery components 3.88e-49
Family Ribosomal protein L18 and S11 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 114615.BRADO3089
Sequence length 129
Comment (Bradyrhizobium ORS278)
Sequence
MAKEAARVRRRERKNIASGVAHVNSSFNNTTITITDAQGNTIAWSSAGTMGFKGSRKSTP
YAAQVAAEDVSKKAQEHGMRTLEVEVAGPGSGRESALRALQAAGFTVTSIRDVTTIPHNG
CRPRKRRRV
Download sequence
Identical sequences A0A1Y6KDU9 A4YSL5 H0SJ40 H0T452 M4ZVX9
WP_006611861.1.32429 WP_006611861.1.46373 WP_006611861.1.48668 WP_006611861.1.54647 WP_006611861.1.58237 WP_006611861.1.84242 gi|146340080|ref|YP_001205128.1| gi|459290930|ref|YP_007514087.1| 114615.BRADO3089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]