SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 114615.BRADO4743 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  114615.BRADO4743
Domain Number 1 Region: 56-160
Classification Level Classification E-value
Superfamily Acid proteases 8.23e-16
Family Retroviral protease (retropepsin) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 114615.BRADO4743
Sequence length 178
Comment (Bradyrhizobium ORS278)
Sequence
MNKVALVLLTMVVTASAVIVYKDPEQAALASDTVSSMLRSRAFRAKAGPPTNAVEIERTR
GGEFALRAKINGVAAPMVVDTGATSVVLTWETAKAAGLPLELLDYDVDVETAGGHTKAAR
LTLDRLAIGKLVERSVPALVVPHGQMKTNLLGMSFLDRLERWEVRSDRLMLHGYPERS
Download sequence
Identical sequences A4YX45
114615.BRADO4743 gi|146341640|ref|YP_001206688.1| WP_011927570.1.46373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]