SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1148.sll1043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1148.sll1043
Domain Number 1 Region: 301-498
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.75e-47
Family Ribonuclease PH domain 1-like 0.00000605
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-45
Family Ribonuclease PH domain 1-like 0.0000277
Further Details:      
 
Domain Number 3 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-27
Family Ribonuclease PH domain 2-like 0.0018
Further Details:      
 
Domain Number 4 Region: 461-560
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.8e-27
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 5 Region: 566-651
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.51e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 6 Region: 629-707
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.01e-16
Family Cold shock DNA-binding domain-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1148.sll1043
Sequence length 718
Comment (Synechocystis PCC6803)
Sequence
MQEFDKSISFDGRDIRLKMGTLAPQAGGSVLIQSGDTAVLVTATRAKGRDGIDFLPLTVD
YEGRLYAAGRIPGGFLRREGRPPEKATLISRLIDRPLRPLFPHWLRDELQIVATTLSMDE
EVPPDVLAVTGASVAVILAQIPFKGPMAAVRVGLVGDDFIINPTYREVHNGDLDLVVAGT
PAGIVMVEAGANQLPEQDIIEAIDFGYEAVQDLINAQRELMTDLGITLATSEPPPVNTAV
EEFIANRASKKIITVLGQFDLGKDGRDAALDEIKATEVETAIAELPETDPVKQSVEEDPK
LVGNLYKALTKKLMRKQIVDDGVRVDGRKLEQVRPISCEVGFLPRRVHGSGLFNRGLTQV
LSLATLGSPGDAQDLADDLHPEDEKRYLHHYNFPPYSVGEARPMRSPGRREIGHGALAER
AIIPVLPPQEDFPYVVRVVSEVLSSNGSTSMGSVCGSTLALMDAGVPIKKPVSGAAMGLI
KEGDEIRILTDIQGIEDFLGDMDFKVAGTDSGITALQMDMKIDGLSMEVVSKAIMQALPA
RLHILDKMLATIREPRPELSPFAPRLLTLKIEPEHIGMVIGPGGKTIKGITEQTSCKIDI
ADDGTVTIASSEGERAERARQMIYNMTRKLNEGEVYLGRVTRIIPIGAFVEVLPGKEGMI
HISQLTEGRVGKVEDEVGVGDEVIVKVREIDSKGRLNLTRLGIHPDEAAEARRNASRG
Download sequence
Identical sequences L8AFT5 P72659
1148.sll1043 gi|383490046|ref|YP_005407722.1| gi|383324162|ref|YP_005385015.1| WP_010871289.1.11876 WP_010871289.1.1889 WP_010871289.1.18904 WP_010871289.1.33690 WP_010871289.1.35395 WP_010871289.1.47586 WP_010871289.1.99424 gi|16329253|ref|NP_439981.1| gi|383320992|ref|YP_005381845.1| gi|16329253|ref|NP_439981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]