SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 119857.FTL_0052 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  119857.FTL_0052
Domain Number 1 Region: 37-178
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-18
Family Glycosyl hydrolases family 32 C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 119857.FTL_0052
Sequence length 179
Comment (Francisella tularensis holarctica)
Sequence
MNCWEDYKNRAKDDSAGAMSLIRQLKVKKDKLLSYPVDDYKNLRNKTIEIKNFDQDITLP
SNLIELNLDFSSDNNWQLDLLENNQGFVINIHYQDNQILVKNSLNEVIDKAFIKDIRSQE
ISVDIFLDTTSIELFVNKEEESITMRFEASDTIKNTMRVSAVNQDDLTIKLYELNSVWK
Download sequence
Identical sequences 119857.FTL_0052 gi|89255499|ref|YP_512860.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]